LL-37 5mg Research Peptide – Specifications, Testing & Ordering
Researchers searching for an LL-37 5mg research peptide usually have more specific purchase intent than someone searching for general information about LL-37.
The compound has already been identified.
The remaining questions typically concern:
What does 5mg mean?
What specifications should be checked?
What analytical documentation should accompany the product?
How should researchers evaluate the listing before ordering?
Review the LL-37 5mg Product
Current product page:
https://peptideslabus.com/products/ll-37-5mg-research-peptide
Researchers should use the live page to verify current product information, pricing, and availability.
What Is LL-37?
LL-37 is a 37-amino-acid human cathelicidin-derived peptide.
Its sequence is:
[LL-37, 37 aa]
It is derived from the human cathelicidin precursor hCAP18.
What Does LL-37 5mg Mean?
The 5mg designation refers to the listed amount of research material associated with the product.
It shouldn’t be confused with:
- Purity
- Concentration after laboratory preparation
- Molecular identity
- Analytical quality
These are separate specifications.
Why Choose a 5mg Research Product?
A 5mg product may be relevant when the planned research project requires that amount of material.
Researchers should estimate total requirements according to:
- Experimental model
- Number of conditions
- Replicates
- Controls
- Number of experiments
- Planned analytical work
Quantity selection should follow the protocol.
Compare Other LL-37 Products
Researchers can review the full catalog:
https://peptideslabus.com/products?q=LL-37
Additional individual listings include:
https://peptideslabus.com/products/crown-ll-37-research-peptide
https://peptideslabus.com/products/peptides-lab-ll37
This allows the 5mg product to be evaluated within the broader LL-37 catalog.
Verify LL-37 Identity
Before ordering, confirm that the product corresponds to LL-37.
Researchers should distinguish:
LL-37
from:
hCAP18
LL-37 is the mature 37-residue peptide derived from the precursor.
Review Purity
If a purity percentage is listed, determine:
- What result is reported?
- Which analytical method produced it?
- Which sample or batch was tested?
- Is supporting documentation available?
A purity number is more useful when its analytical context is clear.
Review HPLC Testing
High-performance liquid chromatography can provide information regarding chromatographic purity.
Researchers should avoid interpreting HPLC purity as proof of every product characteristic.
It doesn’t independently answer all questions about molecular identity or listed quantity.
Review Identity-Related Testing
Researchers should examine available analytical evidence supporting the intended LL-37 identity.
Purity and identity should be treated as related but separate evaluation categories.
Review the COA
A Certificate of Analysis may include:
- Compound identity
- Batch/lot
- Purity
- Analytical method
- Identity-related results
- Additional specifications
Researchers should determine whether the documentation corresponds to the relevant 5mg product or batch.
Check Batch Information
Batch traceability can be important for laboratory records.
Where available, researchers should record the applicable lot alongside experimental documentation.
LL-37 5mg and Scientific Research
LL-37 has been investigated in preclinical and laboratory research involving:
- Innate immune biology
- Host-defense systems
- Microbial interactions
- Inflammatory signaling
- Cytokines
- Epithelial biology
- Cellular responses
These research areas provide scientific context.
They don’t establish the 5mg commercial product as a therapeutic treatment.
Should Researchers Choose 5mg Based on Price?
Price is relevant, but the purchasing decision should include:
price
quantity
analytical specifications
documentation
experimental requirements
A lower-priced product isn’t automatically better.
A higher-priced product isn’t automatically better either.
LL-37 5mg Ordering Checklist
Before ordering:
- Confirm LL-37 is the required compound.
- Verify the 5mg quantity.
- Review sequence/identity information.
- Check purity.
- Review HPLC information.
- Review identity-related testing.
- Examine the COA.
- Check batch information.
- Verify current price.
- Confirm current availability.
- Compare other LL-37 options if necessary.
- Purchase according to experimental requirements.
Review LL-37 5mg
https://peptideslabus.com/products/ll-37-5mg-research-peptide
Browse All LL-37 Products
https://peptideslabus.com/products?q=LL-37
For laboratory research purposes only.
